PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C023266P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Trihelix
Protein Properties Length: 501aa    MW: 57063.6 Da    PI: 5.4373
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C023266P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix932.9e-2947131187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+++e++aL+++r++m++++r+++lk+plWeevs+k+ e g++r++k+Ckek+en+ k++k++k+g+++++  + ++++yf+qlea
  MELO3C023266P1  47 RWPREETMALLKVRSSMDTAFRDASLKAPLWEEVSRKLGELGYNRNAKKCKEKFENIYKYHKRTKDGRSGKS--NGKNYRYFEQLEA 131
                     8********************************************************************974..4457*******85 PP

2trihelix100.11.8e-31328413187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k+e+ aLi++r++++ +++++  k+plWee+s +m++ g+ r++k+Ckekwen+nk++k++ke++kkr +e+s+tcpyf+ql+a
  MELO3C023266P1 328 RWPKEEIDALIQLRTNLQMKYQDSGPKGPLWEEISLAMKKLGYDRNAKRCKEKWENINKYFKRVKESNKKR-PEDSKTCPYFQQLDA 413
                     8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007176.4E-444106IPR001005SANT/Myb domain
PROSITE profilePS500907.22446104IPR017877Myb-like domain
PfamPF138371.3E-1846132No hitNo description
CDDcd122032.13E-2146111No hitNo description
PROSITE profilePS500907.491321385IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.4E-5321384IPR009057Homeodomain-like
SMARTSM007175.7E-4325387IPR001005SANT/Myb domain
CDDcd122031.44E-23327392No hitNo description
PfamPF138371.9E-22327414No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MLEISPSPEN SSAAAATAAA NRVSKEDAAA ASAGVLEEAD RNWPGNRWPR EETMALLKVR  60
SSMDTAFRDA SLKAPLWEEV SRKLGELGYN RNAKKCKEKF ENIYKYHKRT KDGRSGKSNG  120
KNYRYFEQLE ALDNHPLLPS QADSMEEIPK IIPNNVVHNA IPCSVVNPGA NFVETTTTSL  180
STSTTSCSSK ESGGTRKKKR KFVEFFERLM NEVIEKQEKL QKKFVEALEK CEVERLAREE  240
EWKMQELARI KKERERLNQE RSIAAAKDAA VLSFLKVISE QGGTVQFPEN LLLMENLTEK  300
QDDANGERNT STQENINNGN SNQISSSRWP KEEIDALIQL RTNLQMKYQD SGPKGPLWEE  360
ISLAMKKLGY DRNAKRCKEK WENINKYFKR VKESNKKRPE DSKTCPYFQQ LDALYKQKSK  420
KVINNPANPN YELKPEELLM HMMGSQEETH QPESATDDGE AENADNQNQE DEGEEGEDED  480
EDYRIVANSN NNNNTQMQVN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819120.0LN681912.1 Cucumis melo genomic scaffold, anchoredscaffold00059.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008460913.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391171e-116TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A0A0LK120.0A0A0A0LK12_CUCSA; Uncharacterized protein
STRINGVIT_04s0044g00510.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-124Trihelix family protein